NPC2,EDDM1,HE1,NP-C2
  • NPC2,EDDM1,HE1,NP-C2

Anti-NPC2 Antibody 100ul

Ref: AN-HPA000835-100ul
Anti-NPC2

Información del producto

Polyclonal Antibody against Human NPC2, Gene description: Niemann-Pick disease, type C2, Alternative Gene Names: EDDM1, HE1, NP-C2, Validated applications: IHC, WB, Uniprot ID: P61916, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NPC2
Gene Description Niemann-Pick disease, type C2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence PVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSH
Immunogen PVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EDDM1, HE1, NP-C2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P61916
HTS Code 3002150000
Gene ID 10577
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NPC2 Antibody 100ul

Anti-NPC2 Antibody 100ul