UPRT,DKFZp781E1243
  • UPRT,DKFZp781E1243

Anti-UPRT Antibody 100ul

Ref: AN-HPA000805-100ul
Anti-UPRT

Información del producto

Polyclonal Antibody against Human UPRT, Gene description: uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae), Alternative Gene Names: DKFZp781E1243, FUR1, MGC23937, RP11-311P8.3, Validated applications: ICC, IHC, WB, Uniprot ID: Q96BW1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UPRT
Gene Description uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence TGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEIT
Immunogen TGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEIT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp781E1243, FUR1, MGC23937, RP11-311P8.3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96BW1
HTS Code 3002150000
Gene ID 139596
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UPRT Antibody 100ul

Anti-UPRT Antibody 100ul