ICK,KIAA0936,LCK2
  • ICK,KIAA0936,LCK2

Anti-ICK Antibody 25ul

Ref: AN-HPA000791-25ul
Anti-ICK

Información del producto

Polyclonal Antibody against Human ICK, Gene description: intestinal cell kinase, Alternative Gene Names: KIAA0936, LCK2, MGC46090, MRK, Validated applications: ICC, Uniprot ID: Q9UPZ9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ICK
Gene Description intestinal cell kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSS
Immunogen DFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0936, LCK2, MGC46090, MRK
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UPZ9
HTS Code 3002150000
Gene ID 22858
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ICK Antibody 25ul

Anti-ICK Antibody 25ul