ELFN2,dJ63G5.3
  • ELFN2,dJ63G5.3

Anti-ELFN2 Antibody 25ul

Ref: AN-HPA000781-25ul
Anti-ELFN2

Información del producto

Polyclonal Antibody against Human ELFN2, Gene description: extracellular leucine-rich repeat and fibronectin type III domain containing 2, Alternative Gene Names: dJ63G5.3, KIAA1904, LRRC62, PPP1R29, Validated applications: ICC, IHC, WB, Uniprot ID: Q5R3F8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ELFN2
Gene Description extracellular leucine-rich repeat and fibronectin type III domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK
Immunogen GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dJ63G5.3, KIAA1904, LRRC62, PPP1R29
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5R3F8
HTS Code 3002150000
Gene ID 114794
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ELFN2 Antibody 25ul

Anti-ELFN2 Antibody 25ul