ACOT4,FLJ31235
  • ACOT4,FLJ31235

Anti-ACOT4 Antibody 25ul

Ref: AN-HPA000779-25ul
Anti-ACOT4

Información del producto

Polyclonal Antibody against Human ACOT4, Gene description: acyl-CoA thioesterase 4, Alternative Gene Names: FLJ31235, PTE-Ib, PTE2B, Validated applications: IHC, WB, Uniprot ID: Q8N9L9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ACOT4
Gene Description acyl-CoA thioesterase 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PPLGYDLRRIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKPQIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKT
Immunogen PPLGYDLRRIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKPQIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ31235, PTE-Ib, PTE2B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N9L9
HTS Code 3002150000
Gene ID 122970
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ACOT4 Antibody 25ul

Anti-ACOT4 Antibody 25ul