DICER1,Dicer,HERNA
  • DICER1,Dicer,HERNA

Anti-DICER1 Antibody 100ul

Ref: AN-HPA000694-100ul
Anti-DICER1

Información del producto

Polyclonal Antibody against Human DICER1, Gene description: dicer 1, ribonuclease type III, Alternative Gene Names: Dicer, HERNA, K12H4.8-LIKE, KIAA0928, MNG1, Validated applications: IHC, Uniprot ID: Q9UPY3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DICER1
Gene Description dicer 1, ribonuclease type III
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH
Immunogen PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Dicer, HERNA, K12H4.8-LIKE, KIAA0928, MNG1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UPY3
HTS Code 3002150000
Gene ID 23405
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DICER1 Antibody 100ul

Anti-DICER1 Antibody 100ul