C22orf23,EVG1
  • C22orf23,EVG1

Anti-C22orf23 Antibody 25ul

Ref: AN-HPA000650-25ul
Anti-C22orf23

Información del producto

Polyclonal Antibody against Human C22orf23, Gene description: chromosome 22 open reading frame 23, Alternative Gene Names: EVG1, FLJ32787, LOC84645, Validated applications: ICC, Uniprot ID: Q9BZE7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C22orf23
Gene Description chromosome 22 open reading frame 23
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LQCSPTSSQRVLPSKQIASPIYLPPILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDMEERKRKAPPARQKAPAPELDRFEELVKEIQERKEFLADMEALGQGKQYRGIILAEISQKLREMEDIDHRRSEE
Immunogen LQCSPTSSQRVLPSKQIASPIYLPPILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDMEERKRKAPPARQKAPAPELDRFEELVKEIQERKEFLADMEALGQGKQYRGIILAEISQKLREMEDIDHRRSEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EVG1, FLJ32787, LOC84645
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BZE7
HTS Code 3002150000
Gene ID 84645
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C22orf23 Antibody 25ul

Anti-C22orf23 Antibody 25ul