NR4A2,HZF-3,NOT
  • NR4A2,HZF-3,NOT

Anti-NR4A2 Antibody 25ul

Ref: AN-HPA000543-25ul
Anti-NR4A2

Información del producto

Polyclonal Antibody against Human NR4A2, Gene description: nuclear receptor subfamily 4, group A, member 2, Alternative Gene Names: HZF-3, NOT, NURR1, RNR1, TINUR, Validated applications: ICC, IHC, Uniprot ID: P43354, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NR4A2
Gene Description nuclear receptor subfamily 4, group A, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP
Immunogen VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HZF-3, NOT, NURR1, RNR1, TINUR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P43354
HTS Code 3002150000
Gene ID 4929
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NR4A2 Antibody 25ul

Anti-NR4A2 Antibody 25ul