NR4A2,HZF-3,NOT Ver mas grande

Anti-NR4A2 Antibody 100ul

AN-HPA000543-100ul

Producto nuevo

Anti-NR4A2

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name NR4A2
Gene Description nuclear receptor subfamily 4, group A, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP
Immunogen VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HZF-3, NOT, NURR1, RNR1, TINUR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P43354
HTS Code 3002150000
Gene ID 4929
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación ICC, IHC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human NR4A2, Gene description: nuclear receptor subfamily 4, group A, member 2, Alternative Gene Names: HZF-3, NOT, NURR1, RNR1, TINUR, Validated applications: ICC, IHC, Uniprot ID: P43354, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image