FLNA,ABP-280,FLN
  • FLNA,ABP-280,FLN

Anti-FLNA Antibody 100ul

Ref: AN-HPA000368-100ul
Anti-FLNA

Información del producto

Polyclonal Antibody against Human FLNA, Gene description: filamin A, alpha, Alternative Gene Names: ABP-280, FLN, FLN1, OPD1, OPD2, Validated applications: ICC, Uniprot ID: P21333, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FLNA
Gene Description filamin A, alpha
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGS
Immunogen FQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABP-280, FLN, FLN1, OPD1, OPD2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P21333
HTS Code 3002150000
Gene ID 2316
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FLNA Antibody 100ul

Anti-FLNA Antibody 100ul