IL13RA1,CD213a1
  • IL13RA1,CD213a1

Anti-IL13RA1 Antibody 25ul

Ref: AN-HPA000293-25ul
Anti-IL13RA1

Información del producto

Polyclonal Antibody against Human IL13RA1, Gene description: interleukin 13 receptor, alpha 1, Alternative Gene Names: CD213a1, IL-13Ra, NR4, Validated applications: ICC, WB, Uniprot ID: P78552, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IL13RA1
Gene Description interleukin 13 receptor, alpha 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence ETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNT
Immunogen ETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD213a1, IL-13Ra, NR4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P78552
HTS Code 3002150000
Gene ID 3597
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IL13RA1 Antibody 25ul

Anti-IL13RA1 Antibody 25ul