UBA1,A1S9T,CFAP124
  • UBA1,A1S9T,CFAP124

Anti-UBA1 Antibody 100ul

Ref: AN-HPA000289-100ul
Anti-UBA1

Información del producto

Polyclonal Antibody against Human UBA1, Gene description: ubiquitin-like modifier activating enzyme 1, Alternative Gene Names: A1S9T, CFAP124, GXP1, POC20, UBE1, UBE1X, Validated applications: IHC, WB, Uniprot ID: P22314, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UBA1
Gene Description ubiquitin-like modifier activating enzyme 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVP
Immunogen LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names A1S9T, CFAP124, GXP1, POC20, UBE1, UBE1X
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P22314
HTS Code 3002150000
Gene ID 7317
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UBA1 Antibody 100ul

Anti-UBA1 Antibody 100ul