RP2,NM23-H10,NME10
  • RP2,NM23-H10,NME10

Anti-RP2 Antibody 100ul

Ref: AN-HPA000234-100ul
Anti-RP2

Información del producto

Polyclonal Antibody against Human RP2, Gene description: retinitis pigmentosa 2 (X-linked recessive), Alternative Gene Names: NM23-H10, NME10, TBCCD2, Validated applications: IHC, WB, Uniprot ID: O75695, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RP2
Gene Description retinitis pigmentosa 2 (X-linked recessive)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence ELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALE
Immunogen ELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NM23-H10, NME10, TBCCD2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75695
HTS Code 3002150000
Gene ID 6102
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RP2 Antibody 100ul

Anti-RP2 Antibody 100ul