CT45A3 DNAxPab
  • CT45A3 DNAxPab

CT45A3 DNAxPab

Ref: AB-H00441519-W01P
CT45A3 DNAxPab

Información del producto

Rabbit polyclonal antibody raised against a full-length human CT45A3 DNA using DNAx™ Immune technology.
Información adicional
Size 100 ug
Gene Name CT45A3
Gene Alias CT45-3|CT45.3
Gene Description cancer/testis antigen family 45, member A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF-Tr,Flow Cyt-Tr
Immunogen Prot. Seq MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CT45A3 (NP_001017435.1, 1 a.a. ~ 189 a.a) full-length human DNA
Storage Buffer In 1x PBS, pH 7.4
Gene ID 441519

Enviar un mensaje


CT45A3 DNAxPab

CT45A3 DNAxPab