Ver mas grande
CT45A3 DNAxPab
AB-H00441519-W01P
Producto nuevo
CT45A3 DNAxPab
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CT45A3 |
| Gene Alias | CT45-3|CT45.3 |
| Gene Description | cancer/testis antigen family 45, member A3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | CT45A3 (NP_001017435.1, 1 a.a. ~ 189 a.a) full-length human DNA |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 441519 |
Más información
Rabbit polyclonal antibody raised against a full-length human CT45A3 DNA using DNAx™ Immune technology.