TREM1 DNAxPab
  • TREM1 DNAxPab

TREM1 DNAxPab

Ref: AB-H00054210-W01P
TREM1 DNAxPab

Información del producto

Rabbit polyclonal antibody raised against a partial-length human TREM1 DNA using DNAx™ Immune technology.
Información adicional
Size 100 ug
Gene Name TREM1
Gene Alias TREM-1
Gene Description triggering receptor expressed on myeloid cells 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF-Tr,Flow Cyt-Tr
Immunogen Prot. Seq ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TREM1 (NP_061113.1, 21 a.a. ~ 205 a.a) partial-length human DNA
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54210

Enviar un mensaje


TREM1 DNAxPab

TREM1 DNAxPab