FSHB polyclonal antibody
  • FSHB polyclonal antibody

FSHB polyclonal antibody

Ref: AB-PAB8953
FSHB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of FSHB.
Información adicional
Size 100 ug
Gene Name FSHB
Gene Alias -
Gene Description follicle stimulating hormone, beta polypeptide
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,ELISA,Dot
Immunogen Prot. Seq IQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCH
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)
ELISA (1:50000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing Antibody Reactive Against Synthetic Peptide.
Immunogen A synthetic peptide corresponding to amino acids 47-84 of human FSHB.
Storage Buffer In buffer containing 0.02% sodium azide
Gene ID 2488

Enviar un mensaje


FSHB polyclonal antibody

FSHB polyclonal antibody