GCG polyclonal antibody
  • GCG polyclonal antibody

GCG polyclonal antibody

Ref: AB-PAB5057
GCG polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of GCG.
Información adicional
Size 150 ug
Gene Name GCG
Gene Alias GLP1|GLP2|GRPP
Gene Description glucagon
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IP,EIA
Immunogen Prot. Seq HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing Antibody Reactive Against synthetic peptide.
Immunogen A synthetic peptide (conjugated with KLH) corresponding to human GCG.
Storage Buffer In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene ID 2641

Enviar un mensaje


GCG polyclonal antibody

GCG polyclonal antibody