GHRH polyclonal antibody
  • GHRH polyclonal antibody

GHRH polyclonal antibody

Ref: AB-PAB4992
GHRH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of GHRH.
Información adicional
Size 150 ug
Gene Name GHRH
Gene Alias GHRF|GRF|MGC119781
Gene Description growth hormone releasing hormone
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IP,EIA
Immunogen Prot. Seq YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing Antibody Reactive Against synthetic peptide.
Immunogen A synthetic peptide (conjugated with KLH) corresponding to human GHRH.
Storage Buffer In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene ID 2691

Enviar un mensaje


GHRH polyclonal antibody

GHRH polyclonal antibody