NPPC polyclonal antibody
  • NPPC polyclonal antibody

NPPC polyclonal antibody

Ref: AB-PAB4978
NPPC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of NPPC.
Información adicional
Size 150 ug
Gene Name NPPC
Gene Alias CNP
Gene Description natriuretic peptide precursor C
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IP,EIA
Immunogen Prot. Seq DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing Antibody Reactive Against synthetic peptide.
Immunogen A synthetic peptide (conjugated with KLH) corresponding to human NPPC.
Storage Buffer In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene ID 4880

Enviar un mensaje


NPPC polyclonal antibody

NPPC polyclonal antibody