SARS-CoV S polyclonal antibody
  • SARS-CoV S polyclonal antibody

SARS-CoV S polyclonal antibody

Ref: AB-PAB31714
SARS-CoV S polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant SARS-CoV S.
Información adicional
Size 100 ug
Storage Conditions Store at 4C for short term. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Specificity The antibody reacts with spike protein of SARS-CoV. Cross-reacts to most spike proteins from other subtypes of SARS-CoV.
Application Key WB,ELISA
Immunogen Prot. Seq CTTFDDVQAPNYTQHTSSMRGVYYPDEIFR
Form Liquid
Recomended Dilution ELISA
Western Blot (1:100-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species SARS-CoV
Immunogen A synthetic peptide corresponding to amino acids 19-48 of SARS-CoV S.
Storage Buffer In PBS.
Iso type IgG

Enviar un mensaje


SARS-CoV S polyclonal antibody

SARS-CoV S polyclonal antibody