PPID polyclonal antibody
  • PPID polyclonal antibody

PPID polyclonal antibody

Ref: AB-PAB31676
PPID polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PPID.
Información adicional
Size 100 uL
Gene Name PPID
Gene Alias CYP-40|CYPD|MGC33096
Gene Description peptidylprolyl isomerase D
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq FITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 133-207 of human PPID.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5481
Iso type IgG

Enviar un mensaje


PPID polyclonal antibody

PPID polyclonal antibody