SST polyclonal antibody
  • SST polyclonal antibody

SST polyclonal antibody

Ref: AB-PAB31674
SST polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SST.
Información adicional
Size 100 uL
Gene Name SST
Gene Alias SMST
Gene Description somatostatin
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 25-107 of human SST.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6750
Iso type IgG

Enviar un mensaje


SST polyclonal antibody

SST polyclonal antibody