TAGLN polyclonal antibody
  • TAGLN polyclonal antibody

TAGLN polyclonal antibody

Ref: AB-PAB31628
TAGLN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TAGLN.
Información adicional
Size 100 uL
Gene Name TAGLN
Gene Alias DKFZp686P11128|SM22|SMCC|TAGLN1|WS3-10
Gene Description transgelin
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P,IF
Immunogen Prot. Seq EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 19-94 of human TAGLN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6876
Iso type IgG

Enviar un mensaje


TAGLN polyclonal antibody

TAGLN polyclonal antibody