JUNB polyclonal antibody
  • JUNB polyclonal antibody

JUNB polyclonal antibody

Ref: AB-PAB31621
JUNB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human JUNB.
Información adicional
Size 100 uL
Gene Name JUNB
Gene Alias AP-1
Gene Description jun B proto-oncogene
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq SLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 28-146 of human JUNB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3726
Iso type IgG

Enviar un mensaje


JUNB polyclonal antibody

JUNB polyclonal antibody