THOC1 polyclonal antibody
  • THOC1 polyclonal antibody

THOC1 polyclonal antibody

Ref: AB-PAB31617
THOC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human THOC1.
Información adicional
Size 100 uL
Gene Name THOC1
Gene Alias HPR1|P84|P84N5
Gene Description THO complex 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq VFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWS
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 154-240 of human THOC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9984
Iso type IgG

Enviar un mensaje


THOC1 polyclonal antibody

THOC1 polyclonal antibody