PRMT2 polyclonal antibody
  • PRMT2 polyclonal antibody

PRMT2 polyclonal antibody

Ref: AB-PAB31612
PRMT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PRMT2.
Información adicional
Size 100 uL
Gene Name PRMT2
Gene Alias HRMT1L1|MGC111373
Gene Description protein arginine methyltransferase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSW
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PRMT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3275
Iso type IgG

Enviar un mensaje


PRMT2 polyclonal antibody

PRMT2 polyclonal antibody