USP25 polyclonal antibody
  • USP25 polyclonal antibody

USP25 polyclonal antibody

Ref: AB-PAB31601
USP25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human USP25.
Información adicional
Size 100 uL
Gene Name USP25
Gene Alias USP21
Gene Description ubiquitin specific peptidase 25
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq QPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQKLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIQIITKASHEHEDKSPETVLQSIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human USP25.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 29761
Iso type IgG

Enviar un mensaje


USP25 polyclonal antibody

USP25 polyclonal antibody