CTSB polyclonal antibody
  • CTSB polyclonal antibody

CTSB polyclonal antibody

Ref: AB-PAB31599
CTSB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CTSB.
Información adicional
Size 100 uL
Gene Name CTSB
Gene Alias APPS|CPSB
Gene Description cathepsin B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CTSB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1508
Iso type IgG

Enviar un mensaje


CTSB polyclonal antibody

CTSB polyclonal antibody