GOT2 polyclonal antibody
  • GOT2 polyclonal antibody

GOT2 polyclonal antibody

Ref: AB-PAB31598
GOT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GOT2.
Información adicional
Size 100 uL
Gene Name GOT2
Gene Alias FLJ40994|KAT4|KATIV|mitAAT
Gene Description glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVER
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GOT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2806
Iso type IgG

Enviar un mensaje


GOT2 polyclonal antibody

GOT2 polyclonal antibody