BRE polyclonal antibody
  • BRE polyclonal antibody

BRE polyclonal antibody

Ref: AB-PAB31593
BRE polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human BRE.
Información adicional
Size 100 uL
Gene Name BRE
Gene Alias BRCC4|BRCC45
Gene Description brain and reproductive organ-expressed (TNFRSF1A modulator)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq ALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALQNLA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BRE.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9577
Iso type IgG

Enviar un mensaje


BRE polyclonal antibody

BRE polyclonal antibody