MARK3 polyclonal antibody
  • MARK3 polyclonal antibody

MARK3 polyclonal antibody

Ref: AB-PAB31585
MARK3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MARK3.
Información adicional
Size 100 uL
Gene Name MARK3
Gene Alias CTAK1|KP78|PAR1A
Gene Description MAP/microtubule affinity-regulating kinase 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq QSPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MARK3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4140
Iso type IgG

Enviar un mensaje


MARK3 polyclonal antibody

MARK3 polyclonal antibody