RIF1 polyclonal antibody
  • RIF1 polyclonal antibody

RIF1 polyclonal antibody

Ref: AB-PAB31579
RIF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RIF1.
Información adicional
Size 100 uL
Gene Name RIF1
Gene Alias DKFZp434D1026|DKFZp781N1478|FLJ12870
Gene Description RAP1 interacting factor homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FLPKAKQREGTFSKSDSEKIVNGTKRSSRRAGKAEQTGNKRSKPLMRSEPEKNTEESVEGIVVLENNPPGLLNQTECVSDNQVHLSESTMEHD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RIF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55183
Iso type IgG

Enviar un mensaje


RIF1 polyclonal antibody

RIF1 polyclonal antibody