PTK6 polyclonal antibody
  • PTK6 polyclonal antibody

PTK6 polyclonal antibody

Ref: AB-PAB31574
PTK6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PTK6.
Información adicional
Size 100 uL
Gene Name PTK6
Gene Alias BRK|FLJ42088
Gene Description PTK6 protein tyrosine kinase 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PTK6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5753
Iso type IgG

Enviar un mensaje


PTK6 polyclonal antibody

PTK6 polyclonal antibody