NEK5 polyclonal antibody
  • NEK5 polyclonal antibody

NEK5 polyclonal antibody

Ref: AB-PAB31572
NEK5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NEK5.
Información adicional
Size 100 uL
Gene Name NEK5
Gene Alias MGC75495
Gene Description NIMA (never in mitosis gene a)-related kinase 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ETLTFEDGMKFKEYECVKEHGDYTDKAFEKLHCPEAGFSTQTVAAVGNRRQWDGGAPQTLLQMMAVADITSTCPTGPDSESVLSVSRQEG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NEK5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 341676
Iso type IgG

Enviar un mensaje


NEK5 polyclonal antibody

NEK5 polyclonal antibody