MOBP polyclonal antibody
  • MOBP polyclonal antibody

MOBP polyclonal antibody

Ref: AB-PAB31571
MOBP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MOBP.
Información adicional
Size 100 uL
Gene Name MOBP
Gene Alias MGC87379
Gene Description myelin-associated oligodendrocyte basic protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MOBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4336
Iso type IgG

Enviar un mensaje


MOBP polyclonal antibody

MOBP polyclonal antibody