DMRT1 polyclonal antibody
  • DMRT1 polyclonal antibody

DMRT1 polyclonal antibody

Ref: AB-PAB31552
DMRT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DMRT1.
Información adicional
Size 100 uL
Gene Name DMRT1
Gene Alias DMT1
Gene Description doublesex and mab-3 related transcription factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DMRT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1761
Iso type IgG

Enviar un mensaje


DMRT1 polyclonal antibody

DMRT1 polyclonal antibody