KRT20 polyclonal antibody
  • KRT20 polyclonal antibody

KRT20 polyclonal antibody

Ref: AB-PAB31545
KRT20 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human KRT20.
Información adicional
Size 100 uL
Gene Name KRT20
Gene Alias CD20|CK20|K20|KRT21|MGC35423
Gene Description keratin 20
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human KRT20.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 54474
Iso type IgG

Enviar un mensaje


KRT20 polyclonal antibody

KRT20 polyclonal antibody