NAT9 polyclonal antibody
  • NAT9 polyclonal antibody

NAT9 polyclonal antibody

Ref: AB-PAB31539
NAT9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NAT9.
Información adicional
Size 100 uL
Gene Name NAT9
Gene Alias DKFZp564C103|EBSP
Gene Description N-acetyltransferase 9 (GCN5-related, putative)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MRLNQNTLLLGKKVVLVPYTSEHVPRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFI
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NAT9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 26151
Iso type IgG

Enviar un mensaje


NAT9 polyclonal antibody

NAT9 polyclonal antibody