CRAT polyclonal antibody
  • CRAT polyclonal antibody

CRAT polyclonal antibody

Ref: AB-PAB31529
CRAT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CRAT.
Información adicional
Size 100 uL
Gene Name CRAT
Gene Alias CAT1
Gene Description carnitine acetyltransferase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq RWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CRAT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1384
Iso type IgG

Enviar un mensaje


CRAT polyclonal antibody

CRAT polyclonal antibody