RTDR1 polyclonal antibody
  • RTDR1 polyclonal antibody

RTDR1 polyclonal antibody

Ref: AB-PAB31525
RTDR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RTDR1.
Información adicional
Size 100 uL
Gene Name RTDR1
Gene Alias MGC16968
Gene Description rhabdoid tumor deletion region gene 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCMENLKALLKD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RTDR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 27156
Iso type IgG

Enviar un mensaje


RTDR1 polyclonal antibody

RTDR1 polyclonal antibody