RPA3 polyclonal antibody
  • RPA3 polyclonal antibody

RPA3 polyclonal antibody

Ref: AB-PAB31505
RPA3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RPA3.
Información adicional
Size 100 uL
Gene Name RPA3
Gene Alias REPA3
Gene Description replication protein A3, 14kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RPA3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6119
Iso type IgG

Enviar un mensaje


RPA3 polyclonal antibody

RPA3 polyclonal antibody