DKC1 polyclonal antibody
  • DKC1 polyclonal antibody

DKC1 polyclonal antibody

Ref: AB-PAB31503
DKC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DKC1.
Información adicional
Size 100 uL
Gene Name DKC1
Gene Alias CBF5|DKC|FLJ97620|NAP57|NOLA4|XAP101
Gene Description dyskeratosis congenita 1, dyskerin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DKC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1736
Iso type IgG

Enviar un mensaje


DKC1 polyclonal antibody

DKC1 polyclonal antibody