IRAK3 polyclonal antibody
  • IRAK3 polyclonal antibody

IRAK3 polyclonal antibody

Ref: AB-PAB31497
IRAK3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human IRAK3.
Información adicional
Size 100 uL
Gene Name IRAK3
Gene Alias ASRT5|FLJ13601|IRAK-M|IRAKM
Gene Description interleukin-1 receptor-associated kinase 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SWLDVRHIEKYVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIPEHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IRAK3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 11213
Iso type IgG

Enviar un mensaje


IRAK3 polyclonal antibody

IRAK3 polyclonal antibody