CDC16 polyclonal antibody
  • CDC16 polyclonal antibody

CDC16 polyclonal antibody

Ref: AB-PAB31494
CDC16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CDC16.
Información adicional
Size 100 uL
Gene Name CDC16
Gene Alias APC6
Gene Description cell division cycle 16 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq KDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CDC16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8881
Iso type IgG

Enviar un mensaje


CDC16 polyclonal antibody

CDC16 polyclonal antibody