TNNT2 polyclonal antibody
  • TNNT2 polyclonal antibody

TNNT2 polyclonal antibody

Ref: AB-PAB31478
TNNT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TNNT2.
Información adicional
Size 100 uL
Gene Name TNNT2
Gene Alias CMH2|CMPD2|MGC3889|RCM3|TnTC|cTnT
Gene Description troponin T type 2 (cardiac)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IEEVVEEYEEEEQEEAAVEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TNNT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7139
Iso type IgG

Enviar un mensaje


TNNT2 polyclonal antibody

TNNT2 polyclonal antibody