DLC1 polyclonal antibody
  • DLC1 polyclonal antibody

DLC1 polyclonal antibody

Ref: AB-PAB31477
DLC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DLC1.
Información adicional
Size 100 uL
Gene Name DLC1
Gene Alias ARHGAP7|FLJ21120|HP|STARD12|p122-RhoGAP
Gene Description deleted in liver cancer 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DLC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10395
Iso type IgG

Enviar un mensaje


DLC1 polyclonal antibody

DLC1 polyclonal antibody