ARPP-21 polyclonal antibody
  • ARPP-21 polyclonal antibody

ARPP-21 polyclonal antibody

Ref: AB-PAB31475
ARPP-21 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ARPP-21.
Información adicional
Size 100 uL
Gene Name ARPP-21
Gene Alias FLJ32997|RCS
Gene Description cyclic AMP-regulated phosphoprotein, 21 kD
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P,IF
Immunogen Prot. Seq EQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQEYT
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ARPP-21.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10777
Iso type IgG

Enviar un mensaje


ARPP-21 polyclonal antibody

ARPP-21 polyclonal antibody