DNAJB11 polyclonal antibody
  • DNAJB11 polyclonal antibody

DNAJB11 polyclonal antibody

Ref: AB-PAB31470
DNAJB11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DNAJB11.
Información adicional
Size 100 uL
Gene Name DNAJB11
Gene Alias ABBP-2|ABBP2|DJ9|EDJ|ERdj3|ERj3|HEDJ|PRO1080|UNQ537|hDj9
Gene Description DnaJ (Hsp40) homolog, subfamily B, member 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DNAJB11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 51726
Iso type IgG

Enviar un mensaje


DNAJB11 polyclonal antibody

DNAJB11 polyclonal antibody