SEMA4D polyclonal antibody
  • SEMA4D polyclonal antibody

SEMA4D polyclonal antibody

Ref: AB-PAB31457
SEMA4D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SEMA4D.
Información adicional
Size 100 uL
Gene Name SEMA4D
Gene Alias C9orf164|CD100|FLJ33485|FLJ34282|FLJ39737|FLJ46484|M-sema-G|MGC169138|MGC169141|SEMAJ|coll-4
Gene Description sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SEMA4D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10507
Iso type IgG

Enviar un mensaje


SEMA4D polyclonal antibody

SEMA4D polyclonal antibody