BNIP3L polyclonal antibody
  • BNIP3L polyclonal antibody

BNIP3L polyclonal antibody

Ref: AB-PAB31456
BNIP3L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human BNIP3L.
Información adicional
Size 100 uL
Gene Name BNIP3L
Gene Alias BNIP3a|NIX
Gene Description BCL2/adenovirus E1B 19kDa interacting protein 3-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BNIP3L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 665
Iso type IgG

Enviar un mensaje


BNIP3L polyclonal antibody

BNIP3L polyclonal antibody